slide 1

Back to the List of the Granted Patents                                                Click here to download AP2646 PDF

(11)    Patent No :    AP 2646    (73) Applicant(s)       
(21)    Application No :    AP/P/2008/004571    PepTcell Limited, 100 Fetter Lane, London, EC4A  1BN,       
            United Kingdom       
(22)    Filing Date :    05.02.2007           
(24)    Date of Grant &    17.04.2013                               
(45)    Publication :
(30)  Priority Data    (72) Inventors

    (33) Country    (31) Number    (32) Date    STOLOFF Gregory Alan, United Kingdom   
    GB            0602416.0        07.02.2006    CAPARROS -WANDERLEY Wilson Romero, United   
    GB            0613977.8        13.07.2006       
                                (74) Representative   
(84)    Designated State                   
    BW    GM    GH    KE    LS    MW    MZ   NA   SL    FISHER CORMACK & BOTHA   
    SD    SZ    T Z    UG    ZM    ZW               
(51)    International    Classification    C07K 14/11 (2006.01)    A61K 39/145 (2006.01)   
(54)    Title

Peptide sequences and compositions

(57)    Abstract

Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP



wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.
(56)    Documents Cited : DATABASE Uniprot 1 November 1996

2005/099088 A1 WO 2005/120564 A 38, no. 1 April 1981 BOON ACM et al.


Join our newsletter for CIPIT news through subscriptions!


Social Media


Contact Us

TEL : (254) 703 034 612